DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and slc17a7

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001072608.1 Gene:slc17a7 / 780064 XenbaseID:XB-GENE-5742677 Length:576 Species:Xenopus tropicalis


Alignment Length:504 Identity:152/504 - (30%)
Similarity:243/504 - (48%) Gaps:42/504 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QRHLQTFLLFLSIVVNYMAKFNAGVAVVAMTNAENT----NP---NFPEYDWNEMERSYILSSFF 70
            :|::...:..|...:::..:.|.|||:|:|.| .||    |.   ...::.|:......|..|||
 Frog    61 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVN-NNTVYKGNKIVIEQAQFTWDPETVGMIHGSFF 124

  Fly    71 WGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIP-------WCVSWGGWQAYCAIRMSMGL 128
            ||||:||..||::|:::.|......:.:.::.|.:|||       .||        ..:|:..||
 Frog   125 WGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACV--------ICVRILQGL 181

  Fly   129 FQGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGVG 193
            .:|..:|..|...:.|.|..||:||...|..|...|.:|||..:|:|...| ||..:|||....|
 Frog   182 VEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYS-GWSSVFYVYGSFG 245

  Fly   194 VLWCIVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEE--AELKATGPIPVPWKAIWTSVPF 256
            ::|.:.|.:.....|.....|.|.|..|||.||..|.....  |:.||      ||:..:||:|.
 Frog   246 IMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKA------PWRKFFTSMPV 304

  Fly   257 WALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILLTRG 321
            :|::|...|:||.:..|....|||...|...::....|.||||:|...::..:...|||.|.|:.
 Frog   305 YAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKR 369

  Fly   322 IMSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTINTIDLSPN 386
            |||.|.:||.:|...|.:.|..|:.|.:  :..:.:|:..:...||.:..:..|..:|.:|::|.
 Frog   370 IMSTTNVRKMMNCGGFGMEATLLLVVGY--SHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPR 432

  Fly   387 HAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKMVNQP 451
            :|.|||||.|....:..::.||:||.:.| ...||:||.||:|::::...|.:.|..|.....||
 Frog   433 YASILMGISNGVGTLSGMVCPLIVGAMTK-HKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQP 496

  Fly   452 WDAPDFMDKQRSSNLQE-------VGHSKALEAQGSEKVEEAKRNESEG 493
            |..|:....::...:.|       ...|:|..|.||....:....::.|
 Frog   497 WAEPEETSDEKCGFIHEDELADESEEQSQAYGAYGSYGATQTTSQQNGG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 139/441 (32%)
2A0114euk 19..456 CDD:129972 143/452 (32%)
slc17a7NP_001072608.1 2A0114euk 62..503 CDD:129972 145/459 (32%)
MFS 67..490 CDD:119392 139/441 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..547 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.