DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SLC17A1

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_016866688.1 Gene:SLC17A1 / 6568 HGNCID:10929 Length:517 Species:Homo sapiens


Alignment Length:460 Identity:120/460 - (26%)
Similarity:213/460 - (46%) Gaps:41/460 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RHLQTFLLFLSIVVNYMAKFNAGVAVVAMTNAENTN--PNF-----------PEYDWNEMERSYI 65
            |:..:||:....|:....:....:.:|.|.|:.:.:  ||.           |.|:|:...:..|
Human    69 RYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGII 133

  Fly    66 LSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWG-GWQAYCAIRMSMGLF 129
            |||..:|.|:.|...|:....|..:..:..:...|::|.:|||.....| .|...|  |...|..
Human   134 LSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVAWVVVC--RAVQGAA 196

  Fly   130 QGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYV--SCGV 192
            ||.:..........|.|..||.||.:::.:|...|..:.:..:|:: ..|:|||.:||:  :||.
Human   197 QGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVI-CESLGWPMVFYIFGACGC 260

  Fly   193 GVLWCIVWWIFGANQPRESKFIGEAELNYIETS----INSSRKAEEAELKATGPIPVPWKAIWTS 253
            .|  |::|::...:.|::...|..:|..||.:|    ::|||::            :|.|||..|
Human   261 AV--CLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQS------------LPIKAILKS 311

  Fly   254 VPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILL 318
            :|.||:........|.::.:....|.::|.:|.:::|.|...|:||||.:|:...:...::|..|
Human   312 LPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKENGFLSSLPYLFAWICGNLAGQLSDFFL 376

  Fly   319 TRGIMSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGST-INTID 382
            ||.|:|:..:||...:..|.:||...:.:.:|.:|..::.:.|:.|  |......:|.. ||.:|
Human   377 TRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSSTFYSIVIFLILA--GATGSFCLGGVFINGLD 439

  Fly   383 LSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKM 447
            ::|.:.|.:.........|..::...|.|:|:|.|.: ..|...||:.|.|...|.|.|:.....
Human   440 IAPRYFGFIKACSTLTGMIGGLIASTLTGLILKQDPE-SAWFKTFILMAAINVTGLIFYLIVATA 503

  Fly   448 VNQPW 452
            ..|.|
Human   504 EIQDW 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 117/446 (26%)
2A0114euk 19..456 CDD:129972 119/455 (26%)
SLC17A1XP_016866688.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148640
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.