DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and CG7091

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster


Alignment Length:465 Identity:107/465 - (23%)
Similarity:203/465 - (43%) Gaps:57/465 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AGVAVVAMTNAENT----------NPNFPE-----YDWNEMERSYILSSFFWGYILTQFMGGWLC 84
            ||::.:...|..:|          ||...|     ..|...:.......:::||:::..:.|:|.
  Fly    68 AGLSRLTEGNVTSTGRCGSPRVVFNPQIQETQSGDLPWTRNQELTFPGVYYYGYVVSISLSGYLA 132

  Fly    85 RRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYCAIRMSMGLFQGFLFPCIHAHLANWCPVKE 149
            .|..::....||.|..|:..:|:| .::...::|.....:..||..|...|.::.....|....|
  Fly   133 DRCSSKRLFIVSLIFEAVAYILLP-AMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTE 196

  Fly   150 RNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGV----GVLWCIVWWIFGANQPRE 210
            |..|.:.|.:|:..|:::....:..|  |:.||...|||..||    |:..|.:.:......|| 
  Fly   197 RTALLSFAYSGLLMGSMLVYPVASYL--SNFGWELSFYVVGGVGLSFGIACCFLVYDTVEQHPR- 258

  Fly   211 SKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPFWALMVTRCCQSWGYSTLQT 275
               |...|::|:..  ..|:..::.:...|    :|||::..:.|.:|.::|....::.:..:..
  Fly   259 ---ISNEEVDYLRQ--GKSQLGQQRQPVVT----IPWKSLLAAPPVYAFILTHMFHTYTFLVIVQ 314

  Fly   276 EMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILLTRGIMSITG-----IRKSVNSI 335
            .||.:|...:..|::.....||.||| ..:.:.|..|:....:.|.:    |     :|:.:..|
  Fly   315 LMPRFMREAMEFDLREVGFLSAAPYL-GGICSKVMCILGGSYVERRV----GPDQNCVRRMLYGI 374

  Fly   336 AFFVPAAALIGVSFLDNTQKTLAVVLMCA------NVGINAGSTIGSTINTIDLSPNHAGILMGI 394
            ...: ..:||||..|.|....:.|::|.|      ::|.:     |.....:..:|:.||:|.|:
  Fly   375 CSIL-TTSLIGVIILANCDDKILVLVMFAFMMATTDMGFS-----GYWPTLLYFAPSFAGLLSGL 433

  Fly   395 VNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKMVN-QPWDAPDFM 458
            .|..:::...|.|.||..:|... .:::|.:| :::.::|....::..||....| ||||....|
  Fly   434 ANGMAHLSGFLAPHLVAALVHTG-SKDEWNVV-LMTLIVFNTMAMLVFAFCSSTNLQPWDPRSRM 496

  Fly   459 DKQRSSNLQE 468
            :|..|.:.||
  Fly   497 EKTASPSAQE 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 95/438 (22%)
2A0114euk 19..456 CDD:129972 102/451 (23%)
CG7091NP_650243.2 2A0114euk 77..498 CDD:129972 101/446 (23%)
MFS 115..482 CDD:119392 88/392 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.