DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and MFS18

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:461 Identity:123/461 - (26%)
Similarity:194/461 - (42%) Gaps:73/461 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IGQRHLQTFLLFLSIVVN----YMAKFNAGVAVVAMTNAENTNPNFPEYDWNEMERSYILSSFFW 71
            |..|| :..:.|::::..    |..:....:.|.|:.:|:.         |::.:...:||||||
  Fly    20 IWTRH-EKRVWFITLITGTCMLYSTRTTMPLLVPAVASAQK---------WSKTDSGTVLSSFFW 74

  Fly    72 GYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSW--GGWQAYC-----AIRMSMGLF 129
            ||.|||.:||:...|:|.:..:..:.||.:|:..|:| .:.|  |..::|.     |||:..|..
  Fly    75 GYTLTQVVGGYFSDRFGGQRVILFAAIGWSLITFLMP-TIIWTAGSIKSYAIPFIVAIRILNGAL 138

  Fly   130 QGFLFP-CIHAHLANWCPVKERNRLGALANTGIDCGTLV-AMFASGLLAASSIGWPGIFYVSCGV 192
            ||..|| .|.....|.|| .||:....|...|...|||: .:..|.||  ...||..:|.|...:
  Fly   139 QGVHFPSMISLTSQNLCP-NERSSFFGLLTAGSALGTLLTGIMGSFLL--DYFGWSYVFRVIGLM 200

  Fly   193 GVLWCIVWWIFGANQPRESKFIGEAELNYIETSINSSR---KAEEAELKATGPIPVPWKAIWTSV 254
            |:.|.:|...:..          ..|.|.|......||   ....||..|     |||...:..:
  Fly   201 GIAWALVLRYYAM----------AGERNRIINIATPSRLCANKSPAETSA-----VPWLRYFRRL 250

  Fly   255 PFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFV-------YLI 312
            .|||.::|..|:...:..|.:.:|.|             .:...|:...||:..:       ..:
  Fly   251 SFWACVLTHACEMNCFFVLLSWLPTY-------------FHDGFPHAKGWVVNMIPWLALPPCTL 302

  Fly   313 IADILLTRGI---MSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTI 374
            .|..|.||.:   ...|.:||.:.|..|.....||..:|...:..  .|::.|...:|.......
  Fly   303 FAKYLTTRLLAREWHTTTVRKVIQSCCFAAQNLALFVMSRTSDFH--TALICMTIIIGGTGFHNN 365

  Fly   375 GSTINTIDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNI 439
            ..|:|..||:|.|:|.:.|::||...|...|...|.|.|::   ..:.|.:||..:|.|..||.|
  Fly   366 AVTVNPQDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILE---LTQSWPMVFSAAAGINLVGWI 427

  Fly   440 VYVAFG 445
            :::.||
  Fly   428 IFIVFG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 118/451 (26%)
2A0114euk 19..456 CDD:129972 120/453 (26%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 118/447 (26%)
MFS_1 32..397 CDD:284993 105/407 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451992
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 1 0.950 - 0 Normalized mean entropy S4312
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.