DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and Slc17a4

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_795990.2 Gene:Slc17a4 / 319848 MGIID:2442850 Length:492 Species:Mus musculus


Alignment Length:463 Identity:123/463 - (26%)
Similarity:221/463 - (47%) Gaps:36/463 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RHLQTFLLFLSIVVNYMAKFNAGVAVVAMT---------NAENTNP---------------NFPE 54
            ||...|:|.|.....|..:.|...|:.||.         ||....|               ..|.
Mouse    33 RHGLAFILHLCNFSIYTQQMNLSFAITAMVNTTVASSQLNASTERPPTNSQDVWNETLQESKAPV 97

  Fly    55 YDWNEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAY 119
            |||....:..:|||..:|..:.....|::...:||:..:.:..:.|::|.:.||.... .|....
Mouse    98 YDWTPEIQGILLSSLSYGSFIAPIPTGYVAGVFGAKYVVGLGLLISSVLTLFIPLAAD-AGVALL 161

  Fly   120 CAIRMSMGLFQGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPG 184
            ..:|:..|:.|..:....::..|.|.|.:||::|..:|.:|...||.:.:.|.||: ..::|||.
Mouse   162 IVLRVIQGMAQVMVLTGQYSLWAKWAPPQERSQLITIAASGSMLGTFLVLIAGGLI-CQALGWPY 225

  Fly   185 IFYVSCGVGVLWCIVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKA 249
            |||:..|:|...|::|:....:.|:...||...|..||..|:    ..|:..|..:.||    ||
Mouse   226 IFYIFGGIGCACCLLWFPLVYDDPQNHPFISTGERRYITCSL----AQEDCSLGWSLPI----KA 282

  Fly   250 IWTSVPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIA 314
            :..|:|.||::|:..|:.|..||:....|.|::.||..:::.:.:.||||::...|...:..::|
Mouse   283 MVKSLPLWAIVVSYFCEYWLLSTVMAYTPTYISSVLQANLRDSGILSALPFMFGCVCIILGGLLA 347

  Fly   315 DILLTRGIMSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTIN 379
            |.||:|.|:.:..|||...::.....:..|:.:.::.:::.|....|:.::|..:...: |:.||
Mouse   348 DFLLSRKILRLVTIRKLFTAVGVLASSGILLPLPWVRSSRSTTMAFLVLSSVFASLCDS-GALIN 411

  Fly   380 TIDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAF 444
            .:|::|.:||.|.|::...|.:...:.|.:.|..:..|.: ..|:.||.::|.|..||.:.|:.|
Mouse   412 FLDIAPRYAGFLKGLLQVFSYLAGGIAPTVAGFFISQDSE-FGWRNVFFLAAAIDVVGLLFYLIF 475

  Fly   445 GKMVNQPW 452
            .:...|.|
Mouse   476 SRAEVQDW 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 118/449 (26%)
2A0114euk 19..456 CDD:129972 121/458 (26%)
Slc17a4NP_795990.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
2A0114euk 27..486 CDD:129972 123/463 (27%)
MFS 98..475 CDD:119392 106/388 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.