DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and Slc37a4

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_038936893.1 Gene:Slc37a4 / 29573 RGDID:62066 Length:450 Species:Rattus norvegicus


Alignment Length:405 Identity:91/405 - (22%)
Similarity:154/405 - (38%) Gaps:52/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGW-QAYCAIRMSMGL 128
            |.||....|.:::|:.|.|..:..|| .:|.|.:   |||.|:....||... .|:.|:....||
  Rat    52 ITSSQSAAYAISKFVSGVLSDQMSAR-WLFSSGL---LLVGLVNVVFSWSSTVTAFAALWFLNGL 112

  Fly   129 FQGFLFPCIHAHLANWCPVKERNRLGALANTGID-CGTLVAMFASGLLAASSIGWPGIFYVS--- 189
            .||..:|.....|..|....:.....|:.:|.:: .|:|..:.|:  :.|.|..|.....:|   
  Rat   113 AQGLGWPPCGKILRKWFEPSQFGTWWAVLSTSMNLAGSLGPILAT--ILAQSYSWRSTLALSGSL 175

  Fly   190 CGVGVLWCIVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSV 254
            |.|...:|:   :...|:|.:   :|...|:...:........||:.|:.....|..|  :.::.
  Rat   176 CVVVSFFCL---LLIHNEPAD---VGLRNLDPAPSKGKKGSSKEESTLQDLLLSPYLW--VLSTG 232

  Fly   255 PFWALMVTRCCQSWGYSTLQTE--MPAYMNGVLLMDMKSNALYSALP--YLTSWVMA-------- 307
            ......|..||..||...|..|  ..|.:....:..::...|..::.  ||:...||        
  Rat   233 YLVVFGVKTCCTDWGQFFLIQERGQSALVGSSYISALEVGGLVGSIAAGYLSDRAMAKAGLSVYG 297

  Fly   308 -----FVYLIIADILLTRGIMSITGIRKSVNSIAFFVPA----AALIGVSFLDNTQKTLAVVLMC 363
                 .:.|::|.:..:..:..:|....|... ||:.||    |.|.|.     |:..:.::::.
  Rat   298 NPRHSLLLLMMAGMAASMFLFRVTVTSDSPKE-AFWTPALHPLAELTGF-----TEHEIWILVLG 356

  Fly   364 ANVGINAGSTIG--STINTIDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIV 426
            |..|.::...|.  ..|......||..|....||...:|:...|..|....|.|    ...|...
  Rat   357 AVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIAK----HYSWSTA 417

  Fly   427 FIISAVIFCVGNIVY 441
            |.::.||.....:|:
  Rat   418 FWVAEVICIASTVVF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 91/405 (22%)
2A0114euk 19..456 CDD:129972 91/405 (22%)
Slc37a4XP_038936893.1 MFS_SLC37A4 10..438 CDD:340901 91/405 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.