DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SLC17A5

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001369562.1 Gene:SLC17A5 / 26503 HGNCID:10933 Length:533 Species:Homo sapiens


Alignment Length:434 Identity:120/434 - (27%)
Similarity:214/434 - (49%) Gaps:39/434 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RHLQTFLLFLSIVVNYMAKFNAGVAVVAMTNAENT---------------------NPNFPEYDW 57
            |:....|.|....:.|..:.|..||:|.|.::..|                     |....:|.|
Human    39 RYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQW 103

  Fly    58 NEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWG-GWQAYCA 121
            :...:.:||.|||:|||:||..||::..:.|.::.:....:|:|:|.:..|.....| |  ....
Human   104 DAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVG--PLIV 166

  Fly   122 IRMSMGLFQGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIF 186
            :|...||.:|..||.:||..::|.|..||::|.:::..|...||::::..||:: ...:.|..:|
Human   167 LRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGII-CYYMNWTYVF 230

  Fly   187 YVSCGVGVLWCIVW-WIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAI 250
            |....:|:.|.::| |:. ::.|::.|.|...|..||.:|:.:...::::         |||..|
Human   231 YFFGTIGIFWFLLWIWLV-SDTPQKHKRISHYEKEYILSSLRNQLSSQKS---------VPWVPI 285

  Fly   251 WTSVPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIAD 315
            ..|:|.||::|.....:|.:.||.|.:|.||..:|..:::.|...|:||||.||:...:....||
Human   286 LKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAAD 350

  Fly   316 ILLTRGIMSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTINT 380
            .|..:...|...:|:..:.|....||..|:...|: ....:|||..:..:..:....:.|.:||.
Human   351 NLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFI-GCDYSLAVAFLTISTTLGGFCSSGFSINH 414

  Fly   381 IDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQ 424
            :|::|::||||:||.||.:.|..::.|::...:..|  ...||:
Human   415 LDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTPD--AGVQWR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 119/430 (28%)
2A0114euk 19..456 CDD:129972 119/429 (28%)
SLC17A5NP_001369562.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Dileucine internalization motif 22..23
MFS_SLC17A5 42..458 CDD:340939 119/431 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148586
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.