DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and mfs2

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_592802.1 Gene:mfs2 / 2542991 PomBaseID:SPAC11D3.05 Length:546 Species:Schizosaccharomyces pombe


Alignment Length:399 Identity:70/399 - (17%)
Similarity:130/399 - (32%) Gaps:139/399 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LSIVVNYMAKFNAGVAVVAMTNAENTNPNFPEYDWNEMERSYILSSF----FWGYILTQFMGGWL 83
            |:||..:...|.:    ..:.||..|..:.    :..::|:|:|..|    :.|.|:...:|.::
pombe   198 LAIVRFFQGVFGS----TPLANAGGTISDL----FTPVQRTYVLPGFCTFPYLGPIIGPIIGDFI 254

  Fly    84 CRRY-GARITMFVSTIGSALLVVLI-----------------PWCVSWGGWQAYCAIRMSMGLFQ 130
            .:.| ..|.|.:::.|.:|.::|.:                 .:.....|..||..|.       
pombe   255 TQSYLEWRWTFWINMIWAAAVIVFVFIFFPETHEDTILDYKAKYLRKTTGNTAYYTIH------- 312

  Fly   131 GFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSI--------------G 181
                            .:||:...|:........:|:  |...::...::              |
pombe   313 ----------------ERERDPKNAMIQAATQAVSLI--FTEPIVVCFTLYLTVVYIINYINFEG 359

  Fly   182 WP-------------GIFYVSCGVGVLWC-------IVWWIFGANQPRESKFIGEAELN--YIET 224
            :|             |:.::..|||:: |       |.|.....|:.|......|..|.  :|..
pombe   360 YPIVFAKYGFNKGEQGLSFIGVGVGIV-CAGLCTPFIYWHYLKVNKKRNGVICPEDRLYPLFIGC 423

  Fly   225 SINSSRKAEEAELKATGPIPVPWKAIWTSVP---FWALMVTRCCQSWGYSTLQTEMPAYMNGVLL 286
            .:.              ||.:.|.| ||..|   .|.:.:. ....:|:|.|.....:|.   .:
pombe   424 FLL--------------PISMFWFA-WTCYPHHIHWIVPII-ASAFFGFSLLIVFFVSYN---YI 469

  Fly   287 MDMKSNALYSALPYLT----------SWVMAFVYLIIADILLTRGIMSITGIRKSVNSIAFFVPA 341
            :|...:...|||...|          |.|...:||.:.|...|              |:..|: :
pombe   470 IDSYQHMAPSALAAATLVRYSASGGISMVARPMYLNLGDHWAT--------------SVLGFI-S 519

  Fly   342 AALIGVSFL 350
            .|::.:.|:
pombe   520 VAMVPIPFI 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 70/399 (18%)
2A0114euk 19..456 CDD:129972 70/399 (18%)
mfs2NP_592802.1 MFS 109..530 CDD:119392 70/399 (18%)
MFS_1 112..493 CDD:284993 60/347 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.