DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SPBC1348.05

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_592767.1 Gene:SPBC1348.05 / 2542935 PomBaseID:SPBC1348.05 Length:485 Species:Schizosaccharomyces pombe


Alignment Length:392 Identity:75/392 - (19%)
Similarity:131/392 - (33%) Gaps:105/392 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TFL------LFLSIVVNYMAKFNAGVAVVAMTNAENTNPNFPEYDWNEMERSYILSSFFWGYILT 76
            |||      :|...:.|...:|:|...:|.:.                 ...|.|...|...|..
pombe    52 TFLNQYGDSVFAPSISNIAEQFHASRTLVTLG-----------------ATLYTLGILFGNLIFA 99

  Fly    77 QFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYCAIRMSMGLFQGFLFPCIHAHL 141
            .     |..::|.|....:.....|||.:.|...|:..   .:...|...|||...........|
pombe   100 P-----LSEQFGRRPIYLIGYSVFALLQIPIALSVNLA---MFLVFRFFSGLFGSVGLSNGSGSL 156

  Fly   142 ANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFY---VSCGVGVLWCIV---- 199
            |:....|:|.:...:..|.:..|..:|...||.::.|||||...|:   :..|..:.|..:    
pombe   157 ADLFEKKDRGKYMVIYFTVLSIGPGIAPIISGFISQSSIGWQWEFWILLILSGFNLFWAFLLLKE 221

  Fly   200 -------------WWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIW 251
                         :...|.|:|...:..|:..|  |:..|..|.|.         ||     :|.
pombe   222 TYPPVLNRKKFEKYGEIGENEPVALRLTGKQLL--IKLLILLSMKK---------PI-----SIL 270

  Fly   252 TSVPFWALMVTRCCQSWGYSTLQTEMPAY-------------MNGVLLMDMK---SNALYSALPY 300
            .|.|.  |:...|.....|..:...:.|:             ::|::.:.:.   .:|::.|:|.
pombe   271 LSQPI--LICVACTIGSIYGMINLVLIAFSEVWKSSYDFSPGISGLMYISITLGLFSAVFIAMPI 333

  Fly   301 LTSWVMAFVYLI-------IADILLTRGIMSITGIRKSV--------NSIAFFVP--AAALIGVS 348
            ...:   :.||:       ..:..|..|.:.||.....:        ..|.:|||  .:|::|..
pombe   334 NQKF---YSYLVKRNGGEGEPEFRLPMGFIGITLFEIGILLFGWTARYKIFWFVPTIGSAIMGGG 395

  Fly   349 FL 350
            ::
pombe   396 YI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 75/392 (19%)
2A0114euk 19..456 CDD:129972 74/391 (19%)
SPBC1348.05NP_592767.1 MFS 45..468 CDD:119392 75/392 (19%)
MFS_1 48..422 CDD:284993 75/392 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.