DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SLC37A4

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:412 Identity:89/412 - (21%)
Similarity:155/412 - (37%) Gaps:59/412 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGW-QAYCAIRMSMG 127
            :|.||....|.:::|:.|.|..:..|| .:|.|.:   |||.|:....:|... ..:.|:....|
Human    51 FITSSQSAAYAISKFVSGVLSDQMSAR-WLFSSGL---LLVGLVNIFFAWSSTVPVFAALWFLNG 111

  Fly   128 LFQGFLFPCIHAHLANWCPVKERNRLGALANTGID-CGTLVAMFASGLLAASSIGWPGIFYVSCG 191
            |.||..:|.....|..|....:.....|:.:|.:: .|.|..:.|:  :.|.|..|.....:|..
Human   112 LAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILAT--ILAQSYSWRSTLALSGA 174

  Fly   192 VGVLWCIVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPF 256
            :.|:...:..:...|:|.:   :|...|:.:.:........||:.|:.....|..|  :.::...
Human   175 LCVVVSFLCLLLIHNEPAD---VGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLW--VLSTGYL 234

  Fly   257 WALMVTRCCQSWGYSTLQTEM-------PAYMNGVLLMDMKSNALYSALPYLTSWVMA------- 307
            ....|..||..||...|..|.       .:||:.:.:..:..:.   |..||:...||       
Human   235 VVFGVKTCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSI---AAGYLSDRAMAKAGLSNY 296

  Fly   308 ------FVYLIIADILLTRGIMSITGIRKSVNSIAFFV----PAAALIGVSFLDNTQKTLAVVLM 362
                  .:..::|.:.::..:..:|....|...:||:.    |.|.|.|.     |:..|.::::
Human   297 GNPRHGLLLFMMAGMTVSMYLFRVTVTSDSPKDVAFWTLALHPLAELTGF-----TEHELWILVL 356

  Fly   363 CANVGINAGSTIG--STINTIDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQI 425
            .|..|.::...|.  ..|......||..|....||...:|:...|..|....|.|    ...|..
Human   357 GAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIAK----HYSWST 417

  Fly   426 VFIISAVI--------FCVGNI 439
            .|.::.||        |.:.||
Human   418 AFWVAEVICAASTAAFFLLRNI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 89/412 (22%)
2A0114euk 19..456 CDD:129972 89/412 (22%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 87/408 (21%)
2A0104 18..419 CDD:273319 83/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.