DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and liz1

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001342731.1 Gene:liz1 / 2540342 PomBaseID:SPBC2G2.01c Length:514 Species:Schizosaccharomyces pombe


Alignment Length:489 Identity:100/489 - (20%)
Similarity:173/489 - (35%) Gaps:114/489 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYCAI 122
            ||::...::  |..|||:.|..|.:..:|..||:...|..|...|:.:   :..:....:|...:
pombe    67 NELQDINVV--FTCGYIIGQLPGSYALQRVPARLWFSVMNILWGLMTI---FSFAVHSVRALMIL 126

  Fly   123 RMSMGLFQGFLFPCIHAHLANWCPVKER-NRLGALANTGIDCGTLVAMFASGLLAA--SSI---- 180
            |..|.:.:...|...|..|..|....|. .|.|..:.:|: .||   |||..|..|  ||:    
pombe   127 RFFMAVAEASTFAGTHYILGAWYKESELCKRAGIFSASGL-VGT---MFAGYLQTAVHSSLNGKG 187

  Fly   181 ---GWPGIFYVSCGVGVLWCIVWWIFG----ANQPRESK--FIGEAELNYIETSINSSRKAEEAE 236
               ||..:|.:.   |:| .|...::|    .:.|..:|  :..|.|.......:.:..|.:...
pombe   188 GLSGWRWLFIID---GIL-TIPLSLYGLFLFPDVPETTKAPYFTEQEKELSFKRLPARPKKKPLT 248

  Fly   237 LKATGPIPVPWKAIWTSVPFW-------ALMVTRCCQSW-----GYSTLQ-TEMPAYMNGV-LLM 287
            |||...|...|: |:.....|       |:.|......|     .:|..| ...|..:..| ::.
pombe   249 LKAIKDIVRSWR-IYGLCILWIFSGETQAIAVNVLMGQWMKWSNKFSVAQINNYPTVITAVGVVS 312

  Fly   288 DMKSNALYSALPYLTSWVMAFVYLIIADILLTRGIMSITGIRKSVNSIAFFVPAAALIGVSFLDN 352
            .:.::.:...|.....|.......:|..:..|  |:....:.......|:|.......|      
pombe   313 TLGASVISDKLAGNPRWPFGLFLCVITTVSAT--ILLAWNVPDGAKFFAYFASGCTYAG------ 369

  Fly   353 TQKTLAVVLMCANVGINAGSTIGSTINTIDL---SPNHAGILMGIVNTASNI-----VPILTPL- 408
                .||....||                |:   :....|:::.::|...||     .||:.|. 
pombe   370 ----QAVWFSWAN----------------DICRDNDQERGVVVFLMNMCQNIWHIWWAPIMYPNT 414

  Fly   409 --------LVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKMVNQPWDAPDFMD---KQR 462
                    |:|::|...       |||:.|    |:.:.:.:...::.....||.||.|   :..
pombe   415 DTPRFIKGLIGLLVVGG-------IVFVSS----CIVSYMQIRDKRIKRSIQDAKDFDDVFTEHE 468

  Fly   463 SSNLQEVGHSKALEAQGSEKVEEAKRNESEGIKD 496
            |..|:::|           |.:|...|.:..:|:
pombe   469 SLELKKIG-----------KNDEESLNTTNAVKE 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 88/432 (20%)
2A0114euk 19..456 CDD:129972 90/444 (20%)
liz1NP_001342731.1 MFS_1 37..401 CDD:311564 75/375 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.