DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SPCC417.10

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_588287.1 Gene:SPCC417.10 / 2539419 PomBaseID:SPCC417.10 Length:508 Species:Schizosaccharomyces pombe


Alignment Length:532 Identity:106/532 - (19%)
Similarity:188/532 - (35%) Gaps:156/532 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLFLSIVVNYMAKFNAGVAVVAMTNAENTNPNFPEYDWNEMERSYILSSFFWGYILTQFMGGWLC 84
            ::.|...:.::.|.:...||: |...|:.......|.|:.       ::|:.||::.:|....|.
pombe    68 VMCLVYCIQFLDKTSNSYAVI-MGLKEDLKMEGQMYSWSG-------TAFYLGYLVFEFPASLLL 124

  Fly    85 RRYGARITMFVSTIGSALLVVLIPW----CV-SWGGWQAYCAIRMSMGLFQGFLFPCIHAHLANW 144
            :|:         .:...|.|.|:.|    |: |...:..:.|:|:.:|:.:....|......|.|
pombe   125 QRF---------PLSKTLCVFLVIWGFLLCMTSVANYPGFIALRVLLGMMESAASPGFILLTAQW 180

  Fly   145 CPVKER----------NRLGALANTGIDCGTLVAMFASGLLAASSI---GWPGIFYVSCGVGVLW 196
            ....|:          |.||.:         |.:..|.||...:|:   ||..||.: |||..: 
pombe   181 YKRSEQQLRTSVWVAFNGLGQI---------LGSCMAYGLAKRTSLPMRGWKLIFII-CGVLAI- 234

  Fly   197 CIVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPFWALMV 261
                            |:|...|..:..:                    |:||.:.:.....|:|
pombe   235 ----------------FLGFVILAVVPDN--------------------PFKAWFLTEEDRKLVV 263

  Fly   262 TRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADI---------- 316
            .|             :.|...||.....|.......:..:.:|:| ||..::.:|          
pombe   264 KR-------------LRANKQGVGNNHFKLYQFKETMLDIRTWIM-FVSSVLLNIPNGGIGTFSS 314

  Fly   317 LLTRGIMSITGIRKSVNSIAFFVPAAA-----LIGVSFLD---NTQKTLAVVLMCANVGINAGST 373
            ||.:|.|..    .::.::...:||.|     ||...||.   :.:..||.:..|.       :.
pombe   315 LLIKGTMGY----DTLQTLLMGLPAGACEFGGLIAFGFLSLFIHKRMVLATITTCI-------AL 368

  Fly   374 IGSTINTIDLSPNH--AGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCV 436
            |||.:.:....|..  ||..:.:|:..:.||      :..||..:.....:...|.:|..:.:||
pombe   369 IGSCLLSFAGPPRAQLAGYYLLMVSPGAMIV------MFAIISSNASGYTKKVTVGVIYLIGYCV 427

  Fly   437 GNIVYVAFGKMVNQPWDAPDFMDKQRSS-----------------NLQEVGHSKALEAQGSEKVE 484
            ||::    |....:..|||::|..:.:.                 |.:|......|.|:|  |:|
pombe   428 GNLI----GPQTFKAADAPEYMPAKNTMVGCYAATLVTFPALYYVNWRENKRRDQLAAEG--KIE 486

  Fly   485 EAKRNESEGIKD 496
            .....|.|.:.|
pombe   487 HRPNAEFEDLTD 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 91/461 (20%)
2A0114euk 19..456 CDD:129972 94/473 (20%)
SPCC417.10NP_588287.1 MFS 66..436 CDD:119392 92/466 (20%)
2A0114 71..468 CDD:273326 96/495 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.