DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SLC17A8

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_647480.1 Gene:SLC17A8 / 246213 HGNCID:20151 Length:589 Species:Homo sapiens


Alignment Length:492 Identity:144/492 - (29%)
Similarity:237/492 - (48%) Gaps:27/492 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QRHLQTFLLFLSIVVNYMAKFNAGVAVVAMTNAENT----NPNF--PEYDWNEMERSYILSSFFW 71
            :|::...:..|...:::..:.|.|||:|.|.|....    .|..  .:::|:......|..||||
Human    74 KRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQFNWDPETVGLIHGSFFW 138

  Fly    72 GYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWC--VSWGGWQAYCAIRMSMGLFQGFLF 134
            |||:||..||::..::.|......:...::.|.:.||..  |.:|   ....:|:..||.:|..:
Human   139 GYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYG---CVMCVRILQGLVEGVTY 200

  Fly   135 PCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGVGVLWCIV 199
            |..|...:.|.|..||:||...:..|...|.:|||..:|:| ...|||..:||:....|::|.:.
Human   201 PACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVL-VQYIGWSSVFYIYGMFGIIWYMF 264

  Fly   200 WWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPFWALMVTRC 264
            |.:.....|.....|...|..||||||     .|.|.:.:......|||..:||:|.:|::|...
Human   265 WLLQAYECPAAHPTISNEEKTYIETSI-----GEGANVVSLSKFSTPWKRFFTSLPVYAIIVANF 324

  Fly   265 CQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLI---IADILLTRGIMSIT 326
            |:||.:..|....|||...|....:....|.||:|::   ||..|..|   :||.|.:|.|::.|
Human   325 CRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHM---VMTIVVPIGGQLADYLRSRQILTTT 386

  Fly   327 GIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTINTIDLSPNHAGIL 391
            .:||.:|...|.:.|..|:.|.|  :..|.:|:..:...||.:..:..|..:|.:|::|.:|.||
Human   387 AVRKIMNCGGFGMEATLLLVVGF--SHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASIL 449

  Fly   392 MGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKMVNQPWDAPD 456
            |||.|....:..::.||:||.:.: ...||:||.||:|:|::...|.|.|..|.....|.|..|:
Human   450 MGISNGVGTLSGMVCPLIVGAMTR-HKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPE 513

  Fly   457 FMDKQRSSNLQEVGHSKALEAQGSEKVEEAKRNESEG 493
            .:.:::...:.:...::.:|. ..|.....|:..|.|
Human   514 NLSEEKCGIIDQDELAEEIEL-NHESFASPKKKMSYG 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 134/436 (31%)
2A0114euk 19..456 CDD:129972 137/447 (31%)
SLC17A8NP_647480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..61
2A0114euk 75..513 CDD:129972 138/452 (31%)
MFS 80..502 CDD:119392 134/436 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148604
Domainoid 1 1.000 49 1.000 Domainoid score I11776
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.