DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and Slc37a1

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001229356.1 Gene:Slc37a1 / 224674 MGIID:2446181 Length:531 Species:Mus musculus


Alignment Length:432 Identity:75/432 - (17%)
Similarity:150/432 - (34%) Gaps:91/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVL--IPWCVSWGGWQAYCAIRMSMGLFQ 130
            :|...|.:..::.|.:..|...|..:....:.|.....|  :.:..:......|...::..||.|
Mouse   105 AFLCAYAIGMYLSGIIGERLPIRYYLTFGMLASGAFTALFGLGYFYNIHSLGFYVVTQIINGLVQ 169

  Fly   131 GFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGW----PGIFYVSCG 191
            ...:|.:...|:||.....|..:..:.|:....|.::....:|...::..|.    ||....:.|
Mouse   170 TTGWPSVVTCLSNWFGKGRRGLIMGIWNSHTSVGNILGSLIAGYWVSTCWGLSFIVPGAIVAAMG 234

  Fly   192 VGVLWCIVWWIFGANQPRESKFIGEAELN--YIETSINSSRKAEE-------------------- 234
                  ||.::|....|::.|.......:  ..|..||..|..::                    
Mouse   235 ------IVCFLFLIEHPKDVKCSSTLPTHPRASENGINRFRLQKQTTYSEKNGPLDPELQCLLLS 293

  Fly   235 --------------------AELKATGPIPVPWKAIWTSVPFWALMVTRCCQSWGYSTLQTEMPA 279
                                |.:..||.:.:|....::....:|.:|:.....|        :|.
Mouse   294 DGKNPLHPSHIVVLPADGNMAAISFTGALRIPGVIEFSLCLLFAKLVSYTFLFW--------LPL 350

  Fly   280 YMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILLTRGIMSITGIRKSVNSIAFFV-PAAA 343
            |:..|..:|.|.....|.|..:.......:..:|:|.|..|.  |..|:...:.:...:| .:.:
Mouse   351 YITSVDHLDAKKAGELSTLFDVGGIFGGILAGVISDRLEKRA--STCGLMLLLAAPTLYVFSSVS 413

  Fly   344 LIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTINTIDLSP-------NHA-GILMGIVNTASN 400
            .:|:      :.|:|::|:...: ::....:.:|..:.||..       :|| ..:..|::...:
Mouse   414 RMGL------EATIAMLLLSGAL-VSGPYALITTAVSADLGTHKSLKGNSHALSTVTAIIDGTGS 471

  Fly   401 IVPILTPLLVGIIVKDDHDREQWQIVFII------SAVIFCV 436
            :...|.|||.|:|     ....|..||.:      .|::|.|
Mouse   472 VGAALGPLLAGLI-----SPSGWSNVFYMLMFADACALLFLV 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 75/432 (17%)
2A0114euk 19..456 CDD:129972 75/432 (17%)
Slc37a1NP_001229356.1 MFS_SLC37A1_2 21..514 CDD:340902 75/432 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.