DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and Slc17a8

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_892004.1 Gene:Slc17a8 / 216227 MGIID:3039629 Length:601 Species:Mus musculus


Alignment Length:490 Identity:146/490 - (29%)
Similarity:234/490 - (47%) Gaps:37/490 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IGQRHLQTFLLFLSIVVNYMAKFNAGVAVVAMTNAENT----NPNF--PEYDWNEMERSYILSSF 69
            |.:|::...:..|...:::..:.|.|||:|.|.|....    .|..  .:::|:......|..||
Mouse    85 IPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQFNWDPETVGLIHGSF 149

  Fly    70 FWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWC--VSWGGWQAYCAIRMSMGLFQGF 132
            |||||:||..||::..::.|......:...::.|.:.||..  |.:|   ....:|:..||.:|.
Mouse   150 FWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIPSAARVHYG---CVMGVRILQGLVEGV 211

  Fly   133 LFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGVGVLWC 197
            .:|..|...:.|.|..||:||...:..|...|.:|||..:|:| ...|||..:||:....|::|.
Mouse   212 TYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVL-VQYIGWASVFYIYGMFGIIWY 275

  Fly   198 IVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPFWALMVT 262
            :.|.:.....|.....|..||..||||||     .|.|.|.:......||:..:||:|.:|::|.
Mouse   276 MFWLLQAYECPAAHPTISNAERTYIETSI-----GEGANLASLSKFNTPWRRFFTSLPVYAIIVA 335

  Fly   263 RCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLI---IADILLTRGIMS 324
            ..|:||.:..|....|||...|....:....|.||:|::   ||..|..|   :||.|.:|.|::
Mouse   336 NFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHM---VMTIVVPIGGQLADYLRSRKILT 397

  Fly   325 ITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTINTIDLSPNHAG 389
            .|.:||.:|...|.:.|..|:.|.|  :..|.:|:..:...||.:..:..|..:|.:|::|.:|.
Mouse   398 TTAVRKIMNCGGFGMEATLLLVVGF--SHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYAS 460

  Fly   390 ILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKMVNQPWDA 454
            |||||.|....:..::.||:||.:.| ...||:||.||:|:|::...|.|.|..|.....|.|..
Mouse   461 ILMGISNGVGTLSGMVCPLIVGAMTK-HKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWAD 524

  Fly   455 PDFMDKQRSSNLQEVGHSKALEAQGSEKVEEAKRN 489
            |:.:.:.:...:.:           .|..||.:.|
Mouse   525 PENLSEDKCGIIDQ-----------DELAEETELN 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 136/436 (31%)
2A0114euk 19..456 CDD:129972 139/447 (31%)
Slc17a8NP_892004.1 2A0114euk 88..526 CDD:129972 140/452 (31%)
MFS 93..515 CDD:119392 136/436 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 576..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11710
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.