DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and W04C9.6

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_490737.2 Gene:W04C9.6 / 189185 WormBaseID:WBGene00021028 Length:459 Species:Caenorhabditis elegans


Alignment Length:485 Identity:116/485 - (23%)
Similarity:199/485 - (41%) Gaps:56/485 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFLSIVVNYMAKFNAGVAVVAMTNAENTNPNFPEYDWNEMERSYILSSFFWGYILTQFMGGWLCR 85
            |.|:.:::.|..:|.....:...|:.:|:    :.::.:.|.:::.|....|.:..........:
 Worm    18 LCLTSILSNMNTYNFTKICMQDDNSTSTS----KVNYTKSESNFLQSCVAIGSLAASIPFSISFQ 78

  Fly    86 RYGARITMFVSTIGSALLVVLIPWCVSWG-GWQAYCAIRMSMGLFQGFLFPCIHAHLANWCPVKE 149
            ....:....|:.|.|.:...|||...:.| ||  :.|.|:..|:.....||...:..|||....|
 Worm    79 HLPHKPVFIVAGIISGVSTALIPLASTIGYGW--FVAARICQGMAFSATFPLAGSITANWATPYE 141

  Fly   150 RNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGVGVLWCIVWWIFGANQPRESKFI 214
            ......|.........:..|..||.|.:||.||..::||..||.::...::::|....|.|..::
 Worm   142 HGVFIGLLTGNTQLSNIFTMPVSGWLCSSSGGWTSVYYVHAGVSLVTFSLFFLFFKCSPSEHSWV 206

  Fly   215 GEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPFWALMVTRCCQSWG-YSTLQTEM- 277
            ||.||..|       |:.:..: |.:.|..:|::.|.||:..||..:.    |:| ..|:|... 
 Worm   207 GEKELERI-------REGKSGK-KVSRPKNLPFRHILTSLSLWACWIA----SFGDLITVQLVSQ 259

  Fly   278 --PAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILLTRGIMSITGIRKSVNSIAFFVP 340
              |.||...|..|:.|:...:|||.:..:.......||:|.:   ..:|.|...|..|:||..|.
 Worm   260 FNPQYMKNYLNYDVLSSGFLAALPIIFQFFTKLSSGIISDYI---KFISETLKTKIFNTIALAVA 321

  Fly   341 AAALIGVSFLDNTQKTLAVVLM-CAN--VGIN-AGSTIGSTINTIDLSPNHAGILMGIVNTASNI 401
            |...|.::|:...:..||:::| ||.  :|.| ||....:|::    |..:|...|..:......
 Worm   322 AVFFIVLAFIPQEKHLLAIIIMICAESVMGCNTAGFNKCATLH----SQQYAYFAMQQIMNIWAC 382

  Fly   402 VPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKMVNQPWDAPDFMDKQRSSNL 466
            ...:.|..|.:||.||...: |:..|:..|.:....|.::..|.......|           :.|
 Worm   383 TIFIEPFFVNMIVTDDTFTD-WRNCFLAHAGLLLFVNTIFCLFADASPAKW-----------TRL 435

  Fly   467 QEVGHSKALEAQGSEKVEEAKRNESEGIKD 496
            |:          ....:||.|...|..|:|
 Worm   436 QD----------DDVAIEEEKEEYSGSIED 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 106/431 (25%)
2A0114euk 19..456 CDD:129972 108/443 (24%)
W04C9.6NP_490737.2 2A0114euk 14..432 CDD:129972 107/439 (24%)
MFS 49..424 CDD:119392 100/396 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28615
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.