DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and C01B4.7

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_503683.1 Gene:C01B4.7 / 178722 WormBaseID:WBGene00015271 Length:475 Species:Caenorhabditis elegans


Alignment Length:483 Identity:109/483 - (22%)
Similarity:194/483 - (40%) Gaps:70/483 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QTFLLFLSIVVNYMAKFNAGV---AVVAMTN--AENTNPNFPEYDWNE--MERSYILSSFFWGYI 74
            :.|:|.||:....:.:.|:.:   .|:.|.:  .|....|..|..|.|  .|:|.:.|:...|.:
 Worm    38 RVFILILSLTCMTLTQINSQIFTFTVICMDDLIVEQQTSNLTEPHWIEGTTEKSILFSATAIGAL 102

  Fly    75 LTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGW-QAYCAIRMSMGLFQGFLFPCIH 138
            :.......:....|.|:|:....:.|.|.....|..|::..: ..:|.:...:|:  ..:...:.
 Worm   103 VALIPSVPILNSLGVRLTLSFCGLCSTLGTFFTPLAVTYSFYLVVFCRVLQGIGI--SVILTVLG 165

  Fly   139 AHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGVGV-LWCIVWWI 202
            ...:.|.|..|.:...|:.:.......::.|..||:|..||.||..|:|| .||.. .:..|:::
 Worm   166 VIPSYWSPKTEYSTYLAILSCAWQFSNVIFMPISGILCDSSFGWRSIYYV-FGVATGFFYFVFFM 229

  Fly   203 FGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPFWALMVTRCCQS 267
            |..:.|...|.:.|.||..|            .|.|       |...:..:||:|.:...||..|
 Worm   230 FYTDIPGIHKNVSEKELGQI------------VEGK-------PEHTVREAVPYWKICTDRCVLS 275

  Fly   268 -W--------GYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILLTRGIM 323
             |        |:.||....|.|:..||..|::|....:||||....:..|....|:|        
 Worm   276 AWVSFLGGNLGFITLLLYGPTYLREVLQFDVRSTGYINALPYALCAIYKFGAGKISD-------- 332

  Fly   324 SIT-GIRKSVNSIAFFVPAAALIGVSFLD---NTQKTLAVVLMCANVGINAGSTIGSTINTIDL- 383
            .:| ...|::.:...|.....| |:.::.   .:.:.:|.|.....| :.:|..|.:.:..:.: 
 Worm   333 RVTFASDKAIYTFWLFSSIIGL-GIGYIIMAWTSDRNVAFVAFAFAV-VTSGLIIMACVKCLAMR 395

  Fly   384 SPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYVAFGKMV 448
            ...|....:..::..|..|..::||.|||:. .|:..:||..:|||..:|..:.|..:       
 Worm   396 CQQHCHFAVSAISFLSYCVQFISPLGVGILC-PDNTPDQWSRLFIIITLIMIITNAPF------- 452

  Fly   449 NQPWDAPDFMDKQRSSNLQEVGHSKALE 476
              ||     :..|:::|..:....||.|
 Worm   453 --PW-----LTTQQAANYTKRKDPKAFE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 102/448 (23%)
2A0114euk 19..456 CDD:129972 104/459 (23%)
C01B4.7NP_503683.1 MFS 89..>332 CDD:391944 63/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.