DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and M117.1

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_502234.2 Gene:M117.1 / 178112 WormBaseID:WBGene00010918 Length:523 Species:Caenorhabditis elegans


Alignment Length:510 Identity:107/510 - (20%)
Similarity:198/510 - (38%) Gaps:119/510 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NTGPM---------------IGQRHLQTFLLF------LSIVVN----------YMAKFNAGVAV 39
            ||.|:               :..:|...:::|      |..|:|          ||.| |:.:|.
 Worm    50 NTSPILLGNLEMRCHRFRWNLSMKHRIRWVIFILTWLQLGSVMNCVDVFSFSMVYMEK-NSTIAA 113

  Fly    40 VAMTNAENTNPNFPEYDWNEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLV 104
            .|..:        ..|.:...|:|.::|:...|.::..:....|.::||.|:.:..:::..|::.
 Worm   114 EAGLD--------DIYIYTLEEKSSLISAMAIGSLIGMYPQNVLMQKYGPRLVLTFASLLCAVVT 170

  Fly   105 VLIPWCVSWGGWQAYCAIRMSMGLFQGFL----FPCIHAHLANWCPVKERNRLGALANTGIDCGT 165
            ..:||.:     .....:.:...:|||.|    |..:....:.|.|:||.. :...|.:|.....
 Worm   171 AFMPWAL-----DTNYHVALVFRIFQGILYSADFGVVGYVCSKWSPIKEVG-MSLAALSGFTAAR 229

  Fly   166 LVAMFASGLLAASSIGWPGIFYVSCGVGVLWCIVWWIFGANQPRESKFIGEAELNYI--ETSINS 228
            .|..........|::||..|:|:...:..:..|:|::|..:.|.:...:...||.:|  .|..:.
 Worm   230 AVIQLPLAGWTTSNVGWRPIYYILSIILFISTIIWFLFYRDDPEDHCLMTHHELQHIGGGTKRDK 294

  Fly   229 SRKAEEAELKATGPIPVPWKAIWTSVPFWALMVTRCCQSWGYSTLQTEMPAYMNGV-----LLMD 288
            ::|             .|::.:.|....||:.|.      |::.:.......:.|.     |.||
 Worm   295 TKK-------------TPYREVLTDKSVWAVWVA------GFADIFASFVFLVYGAQYYQYLGMD 340

  Fly   289 MKSNALYSALPYLTSWVMAFV-YLIIADILLTRGIMSITGI---------RKS----VNSIAFFV 339
            :::||          |:.:.. ||.|       |:....||         .||    .|:|:..|
 Worm   341 IQANA----------WLNSMKGYLFI-------GVRVFAGIASDRIRTLPEKSKLRLFNTISLQV 388

  Fly   340 PAAALIGVSFLDNTQKTLAVVLMC---ANVGINAGSTI-GSTINTIDLSPNHAGILMGIVNTASN 400
            ||..|:.|..|......|.|:.:.   |:.|.|.|... |:.:    :|...:..::|.:....:
 Worm   389 PAFFLMLVVLLPREHPYLHVICITFYQASFGFNCGGFYKGAAL----ISRQFSYFVIGYIQLFKS 449

  Fly   401 IVPILTPLLVGIIV-KDDHDRE-QWQIVFIISAVIFCVGNIVYVAFGKMVNQPWD 453
            :..:|.|:|..::| ....|.| .|...|:|.|:...|.|.|||...:  ::|.|
 Worm   450 LATLLEPVLFSLLVLPGSEDSELSWTSYFLIHALTLTVANTVYVLLAR--SEPAD 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 101/472 (21%)
2A0114euk 19..456 CDD:129972 103/482 (21%)
M117.1NP_502234.2 2A0114euk 66..499 CDD:129972 102/489 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.