DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and F41C3.2

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_494849.2 Gene:F41C3.2 / 173821 WormBaseID:WBGene00018268 Length:499 Species:Caenorhabditis elegans


Alignment Length:494 Identity:108/494 - (21%)
Similarity:199/494 - (40%) Gaps:84/494 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SIVVNYMAKFNAGVAVVAMT-----------NAENTN------PNFPEYDWNEMERSYILSSFFW 71
            :||...|....|.|.|...|           |.|:.:      |:...:::::.|:..:.|:.:.
 Worm    39 AIVTGLMTLVQANVHVYNFTVLCMQEEQEKANNESLSRNETILPSSLNFNFSKFEQDLLFSAAYI 103

  Fly    72 GYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYCAIRMSMGLFQGFLFPC 136
            ..:.:..:..:|..|.|.:.|..:.::.|.|..:|.|....:|.| .:.|.|...||....|...
 Worm   104 APLPSIIILYFLTNRSGVKTTFLICSMLSFLSTILTPIATQYGFW-FFWAARFFQGLPTAILGIV 167

  Fly   137 IHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGIFYVSCGVGVLWCIVWW 201
            :.....:|..:.|.....::.........|:.|..|.|:.:.. ||..::|....:..:..:::.
 Worm   168 VSVVTCHWSTLTENGTYVSILAAHYQIAPLLTMPLSALMCSVG-GWSSVYYTQGTITAILIVLFA 231

  Fly   202 IFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKAIWTSVPFWALMVTRCCQ 266
            :|..::|.||||:.:.||..||    ..:..||..::.:   ..|:.||......||:.:|....
 Worm   232 VFYTDKPSESKFVSKGELKAIE----DGKSLEEKHVEKS---KTPFVAIHKDPAVWAIWITSVGG 289

  Fly   267 SWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFV--------------YLIIADIL 317
            :.|:|......|.|:|.||..::.:....:|:||:.|.:...|              ...|....
 Worm   290 TIGFSIFLQYGPTYLNKVLHYNLSTTGWTAAVPYIFSCIARIVAQPLSANCSFLGERLAAIVTTT 354

  Fly   318 LTRGIMSITGIRKSVNSIAFFVPAA-ALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTINTI 381
            :::|.|:|..:      :..|:|.. :.:|       |...::|:: || |:|.   :|.|.:..
 Worm   355 ISQGTMAICFL------VLMFIPQTWSSVG-------QLCYSLVIV-AN-GLNG---VGITRSAQ 401

  Fly   382 DLSPNHAGILMGIVNTA----SNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFC---VGNI 439
            .:...|    |..|.||    :..|.:..||||..:..:|...| |..:|:|   |||   |.|:
 Worm   402 LVCKQH----MSFVYTARAFYNGSVGLFLPLLVNFVAPNDTHNE-WTRLFLI---IFCIVFVSNL 458

  Fly   440 VYVAFGKMVNQPW----------DAPDFMDKQRSSNLQE 468
            :::||.......|          ...|..|::.:|...|
 Worm   459 IFIAFSSTEPAQWTIGTSEVDNRSEQDLEDQKSTSTTVE 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 101/458 (22%)
2A0114euk 19..456 CDD:129972 104/480 (22%)
F41C3.2NP_494849.2 2A0114euk 30..471 CDD:129972 103/466 (22%)
MFS 86..463 CDD:119392 91/411 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.