DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SLC17A3

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001091956.1 Gene:SLC17A3 / 10786 HGNCID:10931 Length:498 Species:Homo sapiens


Alignment Length:466 Identity:122/466 - (26%)
Similarity:218/466 - (46%) Gaps:55/466 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLLFLSIVVNYMAKFNAGVAVVAMTNAENTNP----------------------------NFPEY 55
            |..|.:|..|.:    ..:.:|||.|  :|:|                            ..|.|
Human    47 FCNFTTIAQNVI----MNITMVAMVN--STSPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKAPVY 105

  Fly    56 DWNEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYC 120
            ||:...:..|..:..:|.|||....|:|..|.|.:..:.:|...::.|.:.||....: |.....
Human   106 DWSPQIQGIIFGAVGYGGILTMAPSGYLAGRVGTKRVVGISLFATSFLTLCIPLATDF-GIVLLI 169

  Fly   121 AIRMSMGLFQGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGI 185
            ..|:..||.|..:.....|....|.|.:||:||.::|.:|:..|...|:...|.: :.::|||.:
Human   170 VTRIVQGLSQSSILGGQFAIWEKWGPPQERSRLCSIALSGMLLGCFTAILIGGFI-SETLGWPFV 233

  Fly   186 FYVSCGVGVLWCIVWWIFGANQPRESKFIGEAELNYIETS----INSSRKAEEAELKATGPIPVP 246
            ||:..|||.:.|::|::...:.|....:|..:|..||.:|    :.||::            |:|
Human   234 FYIFGGVGCVCCLLWFVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQ------------PLP 286

  Fly   247 WKAIWTSVPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYL 311
            .||:..|:|.|::.:......|..||:...:|.|::.|..::::.|.|.||||::.:||:..|..
Human   287 IKAMLRSLPIWSICLGCFSHQWLVSTMVVYIPTYISSVYHVNIRDNGLLSALPFIVAWVIGMVGG 351

  Fly   312 IIADILLTRGIMSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGS 376
            .:||.|||:....|| :||....:.....:|.::.:.:| |:....|..|:..:.|::.....|.
Human   352 YLADFLLTKKFRLIT-VRKIATILGSLPSSALIVSLPYL-NSGYITATALLTLSCGLSTLCQSGI 414

  Fly   377 TINTIDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVY 441
            .||.:|::|.::..|||.....|:|.|::.|.:.|.::..|.: ..|:.||.:...:..:|.:.|
Human   415 YINVLDIAPRYSSFLMGASRGFSSIAPVIVPTVSGFLLSQDPE-FGWRNVFFLLFAVNLLGLLFY 478

  Fly   442 VAFGKMVNQPW 452
            :.||:...|.|
Human   479 LIFGEADVQEW 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 118/456 (26%)
2A0114euk 19..456 CDD:129972 122/466 (26%)
SLC17A3NP_001091956.1 2A0114euk 23..497 CDD:129972 122/466 (26%)
MFS 98..481 CDD:119392 108/399 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148688
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.