DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SLC17A2

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens


Alignment Length:475 Identity:112/475 - (23%)
Similarity:217/475 - (45%) Gaps:39/475 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TNTGP-MIGQRHLQTFLLFLSIVVNYMAKFNAGVAVVAMTNA-------------------ENTN 49
            |..|| ....|:....::..|.......:.:..:|::||.|.                   .|::
Human     7 TRKGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTEGPVADAFNNSS 71

  Fly    50 PNFPEYD-------WNEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLI 107
            .:..|:|       |:...:..|.||..:|.|||....|:|...:||:..:....:.|:||.:..
Human    72 ISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFT 136

  Fly   108 PWCVSWGGWQAYCAIRMSMGLFQGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFAS 172
            |....: |......:|...|:.||..:.......|.|.|..||::|..:|.:|...|:.:.:...
Human   137 PLAADF-GVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVG 200

  Fly   173 GLLAASSIGWPGIFYVSCGVGVLWCIVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAEL 237
            ||: :.::.||.|||:....|.:.|::|:....:.|.....|...|..:|.:|:        |:.
Human   201 GLI-SQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSSL--------AQQ 256

  Fly   238 KATGPIPVPWKAIWTSVPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLT 302
            .::....||.||:.|.:|.||:.:......|..:.:.|.:|.|::.:|.::::.:.:.|:||::.
Human   257 PSSPGRAVPIKAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIA 321

  Fly   303 SWVMAFVYLIIADILLTRGIMSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVG 367
            :.....:...:||.||:|.::.:..:||..:|:...:|:...:.:.|:.::. .:.::|:....|
Human   322 AASCTILGGQLADFLLSRNLLRLITVRKLFSSLGLLLPSICAVALPFVASSY-VITIILLILIPG 385

  Fly   368 INAGSTIGSTINTIDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAV 432
            .:.....|..|||:|::|.:|..||||......|..|::....|.::..|.: ..|:.||.:||.
Human   386 TSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLISQDFE-SGWRNVFFLSAA 449

  Fly   433 IFCVGNIVYVAFGKMVNQPW 452
            :...|.:.|:.||:...|.|
Human   450 VNMFGLVFYLTFGQAELQDW 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 104/451 (23%)
2A0114euk 19..456 CDD:129972 108/460 (23%)
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 112/475 (24%)
MFS 81..461 CDD:119392 96/391 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148652
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.