DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SLC17A4

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_005486.1 Gene:SLC17A4 / 10050 HGNCID:10932 Length:497 Species:Homo sapiens


Alignment Length:465 Identity:117/465 - (25%)
Similarity:217/465 - (46%) Gaps:38/465 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RHLQTFLLFLSIVVNYMAKFNAGVAVVAMTN--AENTNPN------------------------F 52
            ||....:|.|.....|..:.|..:|:.||.|  |..:.||                        .
Human    36 RHGLALILQLCNFSIYTQQMNLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMA 100

  Fly    53 PEYDWNEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQ 117
            |.|||:...:..||||..:|..|.....|::...:||:..:......|:.|.:.||...: .|..
Human   101 PAYDWSPEIQGIILSSLNYGSFLAPIPSGYVAGIFGAKYVVGAGLFISSFLTLFIPLAAN-AGVA 164

  Fly   118 AYCAIRMSMGLFQGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGW 182
            ....:|:..|:.|..:....::....|.|..||::|..:|.:|...|:.:.:.|.||| ..:|||
Human   165 LLIVLRIVQGIAQVMVLTGQYSIWVKWAPPLERSQLTTIAGSGSMLGSFIVLLAGGLL-CQTIGW 228

  Fly   183 PGIFYVSCGVGVLWCIVWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPW 247
            |.:||:..|:|...|.:|:....:.|....||...|..||..|:        |:...:....:|.
Human   229 PYVFYIFGGIGCACCPLWFPLIYDDPVNHPFISAGEKRYIVCSL--------AQQDCSPGWSLPI 285

  Fly   248 KAIWTSVPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLI 312
            :|:..|:|.||::|:..|:.|.:.|:....|.|::.||..:::.:.:.||||::...:...:..:
Human   286 RAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL 350

  Fly   313 IADILLTRGIMSITGIRKSVNSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGST 377
            :||.||:|.|:.:..|||...:|....|:..|:.:.:: .:..::.:..:..:..|::....|:.
Human   351 LADFLLSRKILRLITIRKLFTAIGVLFPSVILVSLPWV-RSSHSMTMTFLVLSSAISSFCESGAL 414

  Fly   378 INTIDLSPNHAGILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCVGNIVYV 442
            :|.:|::|.:.|.|.|::...::|...::|...|..:..|.: ..|:.||::||.:...|.:.|:
Human   415 VNFLDIAPRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSE-FGWRNVFLLSAAVNISGLVFYL 478

  Fly   443 AFGKMVNQPW 452
            .||:...|.|
Human   479 IFGRADVQDW 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 111/451 (25%)
2A0114euk 19..456 CDD:129972 115/460 (25%)
SLC17A4NP_005486.1 UhpC 30..491 CDD:332119 117/465 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148622
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.