DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30203 and spon2a

DIOPT Version :9

Sequence 1:NP_725128.2 Gene:CG30203 / 246514 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_571082.1 Gene:spon2a / 30201 ZFINID:ZDB-GENE-990415-160 Length:334 Species:Danio rerio


Alignment Length:298 Identity:91/298 - (30%)
Similarity:135/298 - (45%) Gaps:20/298 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 CCACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAE 241
            |.|...|.|.:|....|:..|..|.:|......:..:::..:|:..||.|..|..||.|||..||
Zfish    38 CSARGPASYIVVFTGHWSPQTFPKQYPLFRPPAQWSKLMVVTHNEQYRLWQEGAPASDGMKSFAE 102

  Fly   242 HGATRTLENEIRENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSPDWI 306
            .|.|..|..:.:|..:...|.::.:..||   |...|.:.....|.|....:||..|:.|||||.
Zfish   103 QGLTVDLVKDAKEARKRRSVGSMYRTAGI---PSGIGHSSTEVLLTPRSPLVSLIVKLIPSPDWF 164

  Fly   307 LGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDHRSPFY 371
            :||.||.|| ....|.:....:|:|:|.|||||.::.|.:.|..||:.:..|||..|:...:.||
Zfish   165 VGVDGLNLC-EGGKWKQEVTFDLHPFDAGTDSGFTFSSPNFPTTPPENITMITSQKPNHPANSFY 228

  Fly   372 DDTGAPMKPLATLYLTRK-KLYIRECEEVP-------------QEGPLECAVHPWNEWTNCSTRC 422
            ......:.||||:::.|: :|.:|:...:.             .|.||:|.|..|:.|..|...|
Zfish   229 YPRLNELPPLATIWVKRQSRLPVRQQNRLSNHILPDASKPHRFSETPLDCEVSMWSSWGLCFGPC 293

  Fly   423 GQ-GYSHRQRSFKNPNLAANFNCDRRLEEFRQCQGTQC 459
            .: |..||.|........:...|. .|||..:|....|
Zfish   294 ARGGLRHRTRYILLKPANSGSPCP-ELEEQEECTPHNC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30203NP_725128.2 Reeler 18..160 CDD:260081
Spond_N 183..372 CDD:283999 62/188 (33%)
TSP1 411..459 CDD:214559 13/48 (27%)
TSP1 492..541 CDD:214559
KU <739..773 CDD:197529
spon2aNP_571082.1 Spond_N 44..230 CDD:283999 63/189 (33%)
TSP1 283..330 CDD:214559 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.