DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18853 and cry5

DIOPT Version :9

Sequence 1:NP_724615.1 Gene:CG18853 / 246511 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_571863.1 Gene:cry5 / 83776 ZFINID:ZDB-GENE-010426-8 Length:519 Species:Danio rerio


Alignment Length:294 Identity:54/294 - (18%)
Similarity:96/294 - (32%) Gaps:81/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKSQLTIARN-------------EINNLRQQVRNLQHVQRKDIETITRLLQDFRCEGCANNNKSA 57
            |.|:|.:.|.             :|..|..:|....:.|.:|.| :.:|.:::..|         
Zfish    69 LNSRLFVVRGSPTEVLPKLFKQWKITRLTFEVDTEPYSQSRDKE-VMKLAKEYGVE--------- 123

  Fly    58 KDKVAGEKQEH--QHQQQTQDQQTGQGQSNYTNGGHCLGEDYAHFRPIGVIRTAFPEKRAVPRQS 120
                ...|..|  .:..:..|:..|:....|             .|...|::.....|:.:|..:
Zfish   124 ----VTPKISHTLYNIDRIIDENNGKTPMTY-------------IRLQSVVKAMGHPKKPIPAPT 171

  Fly   121 IVGSRLRGI-IQLND------GVFTNPEHSLEGLEDFSHLW----------LIYHFHRNN----- 163
              ...:||: ..|:|      |:.|..:..|:......||:          |..|..|.|     
Zfish   172 --NEDMRGVSTPLSDDHEEKFGIPTLEDLGLDTSSLGPHLFPGGEQEALRRLDEHMERTNWVCKF 234

  Fly   164 SHPKAKADNFCFYNE------HYDSLKGLSSWAYQTLDAHR-KDKRDPCYSLEELEKSLTYDDLW 221
            ..||...::......      .:..|...:.| ::..|.:| |...||..|   |...|.:.:.:
Zfish   235 EKPKTSPNSLIPSTTVLSPYVRFGCLSARTFW-WRLADVYRGKTHSDPPVS---LHGQLLWREFF 295

  Fly   222 NSAQLQLVREGKMHGFLRMYWAKKILEWTATPEH 255
            .:..:.:....||.|    ..|...::|...|||
Zfish   296 YTTAVGIPNFNKMEG----NSACVQVDWDNNPEH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 16/79 (20%)
cry5NP_571863.1 PhrB 5..486 CDD:223492 54/294 (18%)
DNA_photolyase 5..170 CDD:279247 21/127 (17%)
FAD_binding_7 213..485 CDD:281440 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0415
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.