DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18853 and Trmo

DIOPT Version :9

Sequence 1:NP_724615.1 Gene:CG18853 / 246511 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_083362.1 Gene:Trmo / 74753 MGIID:1922003 Length:488 Species:Mus musculus


Alignment Length:125 Identity:43/125 - (34%)
Similarity:64/125 - (51%) Gaps:17/125 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GHCLGEDYAHFRPIGVIRTAFPEKRAVPRQSIVGSRLRGIIQLNDGVFTNPEHSLEGLEDFSHLW 154
            |:.|.|      |||.:.:.||.|...|||..:.|..|..:::...:|.||||||.|||:|||:|
Mouse    26 GNLLTE------PIGYLESCFPAKIGTPRQPSICSHSRACLKIRKNIFNNPEHSLMGLEEFSHVW 84

  Fly   155 LIYHFHRN-NSHPKAKADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEK 213
            :::.||:| :.:.|||...        ..|.|..:..:.|...||.:...  .:|.:|||
Mouse    85 ILFVFHKNGHLNYKAKVQP--------PRLNGAKTGVFSTRSPHRPNAIG--LTLAKLEK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 28/63 (44%)
TrmoNP_083362.1 UPF0066 32..159 CDD:187753 40/113 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..242
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7614
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005744
OrthoInspector 1 1.000 - - otm43142
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4138
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.