DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18853 and trmo

DIOPT Version :9

Sequence 1:NP_724615.1 Gene:CG18853 / 246511 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001016423.2 Gene:trmo / 549177 XenbaseID:XB-GENE-1004391 Length:405 Species:Xenopus tropicalis


Alignment Length:188 Identity:56/188 - (29%)
Similarity:76/188 - (40%) Gaps:55/188 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CANNNKSAKDKVAGEKQEHQHQQQTQDQQTGQGQSNYTNGGHCLGEDYAHFRPIGVIRTAFPEKR 114
            |.:.||        :|:|.|       .:.|   ||:...|..|      ..|||.|.:.|..|.
 Frog     3 CDDRNK--------KKKEVQ-------PEIG---SNFLEAGTIL------TTPIGYIESCFMTKN 43

  Fly   115 AVPRQSIVGSRLRGIIQLNDGVFTNPEHSLEGLEDFSHLWLIYHFHRNNS-HPKAKADNFCFYNE 178
            ..|||..|.|..||.::::..||.||||||.|:|.|||:|:::.||:|.. ..|||...      
 Frog    44 GTPRQPSVCSLSRGRLRISKSVFNNPEHSLIGIEQFSHVWILFVFHKNGRLSCKAKVQP------ 102

  Fly   179 HYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHG 236
              ..|.|..:..:.|...||.                      |:..|.|||..|:.|
 Frog   103 --PRLNGAKTGVFSTRSPHRP----------------------NAIGLTLVRLEKVEG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 29/62 (47%)
trmoNP_001016423.2 UPF0066 44..163 CDD:396527 39/123 (32%)
TrmO_C 308..>371 CDD:408188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483097at2759
OrthoFinder 1 1.000 - - FOG0005744
OrthoInspector 1 1.000 - - otm48276
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4138
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.