DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18853 and TRMO

DIOPT Version :9

Sequence 1:NP_724615.1 Gene:CG18853 / 246511 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001358586.1 Gene:TRMO / 51531 HGNCID:30967 Length:441 Species:Homo sapiens


Alignment Length:124 Identity:41/124 - (33%)
Similarity:60/124 - (48%) Gaps:15/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GHCLGEDYAHFRPIGVIRTAFPEKRAVPRQSIVGSRLRGIIQLNDGVFTNPEHSLEGLEDFSHLW 154
            |:.|.|      |:|.:.:.|..|...|||..:.|..|..:::...:|.||||||.|||.|||:|
Human    26 GNLLTE------PVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVW 84

  Fly   155 LIYHFHRNNSHPKAKADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEK 213
            :::.||: |.|...||      ......|.|..:..:.|...||.:...  .:|.:|||
Human    85 ILFVFHK-NGHLSCKA------KVQPPRLNGAKTGVFSTRSPHRPNAIG--LTLAKLEK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 25/62 (40%)
TRMONP_001358586.1 UPF0066 45..164 CDD:376698 34/99 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..284
TrmO_C 335..403 CDD:375815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7614
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483097at2759
OrthoFinder 1 1.000 - - FOG0005744
OrthoInspector 1 1.000 - - otm41071
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.