DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18853 and Trmo

DIOPT Version :9

Sequence 1:NP_724615.1 Gene:CG18853 / 246511 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_038965382.1 Gene:Trmo / 298072 RGDID:1305420 Length:442 Species:Rattus norvegicus


Alignment Length:147 Identity:46/147 - (31%)
Similarity:72/147 - (48%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HQQQTQDQQTGQ--GQSNYTNGGHCLGEDYAHFRPIGVIRTAFPEKRAVPRQSIVGSRLRGIIQL 132
            |:...:|.:|..  .|..|::..:.|.|      |||.:.:.|..|...|||..:.|:.|..:::
  Rat    15 HKSMDEDLKTTNPPKQKLYSSNWNLLTE------PIGYLESCFSAKIGTPRQPSICSQSRACLKI 73

  Fly   133 NDGVFTNPEHSLEGLEDFSHLWLIYHFHRN-NSHPKAKADNFCFYNEHYDSLKGLSSWAYQTLDA 196
            ...:|.||||||.|||.|||:|:::.||:| :.:.|||...        ..|.|..:..:.|...
  Rat    74 RKSIFNNPEHSLMGLEQFSHVWILFVFHKNGHLNYKAKVQP--------PRLNGAKTGVFSTRSP 130

  Fly   197 HRKDKRDPCYSLEELEK 213
            ||.:...  .:|.:|||
  Rat   131 HRPNAIG--LTLAKLEK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 27/63 (43%)
TrmoXP_038965382.1 UPF0066 56..175 CDD:396527 34/100 (34%)
TrmO_C 336..>398 CDD:408188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483097at2759
OrthoFinder 1 1.000 - - FOG0005744
OrthoInspector 1 1.000 - - otm45211
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4138
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.