DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30187 and CG3088

DIOPT Version :10

Sequence 1:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:63/177 - (35%) Gaps:58/177 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LPDLEDYWTGIVTHGYLVIR-----------------------PKDHNYVVAYID-RPMYAAFNE 99
            |.||:|.:.|    |..:|:                       |..||.:  |:: |||.....|
  Fly   542 LKDLQDDFMG----GAEIIKSDPVVSFRETVCDRSTRTVMSKSPNKHNRL--YMEARPMEEGLAE 600

  Fly   100 YLPRGYRTELSRFNLKWQPMPFS---SKPFGIYYNKGAVK---GFYVEKTVPNHEVNMLKG--WV 156
            .:..|      |...:..|...|   ::.||  ::|...|   .|..|.|.||..|:|.||  ::
  Fly   601 AIDDG------RIGPRDDPKIRSKILAEEFG--WDKDLAKKIWAFGPETTGPNMVVDMCKGVQYL 657

  Fly   157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDV 203
            ::::......:...|:.....|.|            :.|.|..:.||
  Fly   658 NEIKDSVVAGFQWASKEGPLAEEN------------MRGICFEVCDV 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 39/177 (22%)
Trypsin 316..>384 CDD:459667
CG3088NP_648334.1 Tryp_SPc 29..244 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.