DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30187 and Gzmm

DIOPT Version :10

Sequence 1:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_063119183.1 Gene:Gzmm / 29252 RGDID:620022 Length:266 Species:Rattus norvegicus


Alignment Length:193 Identity:56/193 - (29%)
Similarity:92/193 - (47%) Gaps:20/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTRLAWIPVIFWFLKDVGASIFLDQICGINIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTL 65
            |:.|  |..::...||.:.|       .|.....:|.||..|...:..:|.::.|....:|||.|
  Rat     1 MEVR--WSLLLLLALKTLWA-------VGNRFEAQIIGGREAVPHSRPYMVSLQNTKSHVCGGVL 56

  Fly    66 IHKRFVLTAAHCIVDQDVQSVSL--GAYNKSDPAD---RKDVITAVVHSSFDVRASYENDIGLLK 125
            :|:::|||||||: .:.:|.:.|  |.::..||.|   ...:..|:.|..::::  ||||:.|||
  Rat    57 VHQKWVLTAAHCL-SEPLQQLKLVFGLHSLHDPQDPGLTFYIKQAIKHPGYNLK--YENDLALLK 118

  Fly   126 LSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWG-TLRGNKTSDILQTIILNHLDREEC 187
            |...|..:..::|:.:. .|.........|...| ||| |.:..:.:..||.:.|..||...|
  Rat   119 LDGRVKPSKNVKPLALP-RKPRDKPAEGSRCSTA-GWGITHQRGQLAKSLQELDLRLLDTRMC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 49/159 (31%)
Trypsin 316..>384 CDD:459667
GzmmXP_063119183.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.