DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and EEF1E1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens


Alignment Length:160 Identity:51/160 - (31%)
Similarity:76/160 - (47%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCDVATVQKIANCLGVNPGK--VQLNEEQVVTRTSGQKKSVAGFASILESLASESKSETAQNSRA 63
            |...|.:..:...||::.|.  ....|.|:....:....|:.|..:|...|..::..|....|.|
Human     1 MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTA 65

  Fly    64 SREVEAQVYQWIEFSVLYVAPGSKDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDL 128
              |.:|.|.||:|:.|..| .|...|.....||.|.|.....|.||.|:..||||:.:||.::..
Human    66 --EEKAIVQQWLEYRVTQV-DGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRF 127

  Fly   129 VKSLSPVDKEVYLNLSRWFDHLQNRADVHQ 158
            :..|:..:||.|||:||||.|:|:...:.|
Human   128 IVDLTVQEKEKYLNVSRWFCHIQHYPGIRQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 37/94 (39%)
EEF1E1NP_004271.1 N-terminal 2..56 10/53 (19%)
Linker 57..63 1/5 (20%)
C-terminal 64..152 37/90 (41%)
GST_C_AIMP3 65..165 CDD:198338 38/96 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10763
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5224
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49206
OrthoDB 1 1.010 - - D1422931at2759
OrthoFinder 1 1.000 - - FOG0007808
OrthoInspector 1 1.000 - - oto89064
orthoMCL 1 0.900 - - OOG6_108114
Panther 1 1.100 - - LDO PTHR44490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5219
SonicParanoid 1 1.000 - - X5757
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.