DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and CAM1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:25/101 - (24%)
Similarity:38/101 - (37%) Gaps:31/101 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EFSVLYVAPGSKDK----YVSKQLLAD-FNKLFASKSYLVG----------------------HF 113
            |:|:..|.....|:    ::|..|:.. ||:|.||..|:.|                      .:
Yeast   296 EYSLWKVTYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDY 360

  Fly   114 ITLADLAVYYAIYDLVKSLSPV---DKEVYLNLSRW 146
            :...|:|..:..||..| |.|.   |||...|:..|
Yeast   361 VPAFDVAPDWESYDYAK-LDPTNDDDKEFINNMWAW 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 25/101 (25%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342
GST_C_EF1Bgamma_like 92..214 CDD:198290
EF1G 255..359 CDD:395522 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.