DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and URE2

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:28/120 - (23%)
Similarity:47/120 - (39%) Gaps:21/120 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ESLASESKSETAQNSRASREVEAQVYQWIEFSVLYVAPGSKDKYVSKQLLADFNKLFASKSYLVG 111
            :.:||..:..|.:..|....||..:.:..|..|:.:...:...|.:.......::.|....:|||
Yeast   239 QKIASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVG 303

  Fly   112 HFITLADLAVYYAIYDLVKSLSPVDK----------EVYLNLSRWFDHLQNRADV 156
            ..:|:||||       .|...:.||:          |||    :|..|:..|..|
Yeast   304 DKLTIADLA-------FVPWNNVVDRIGINIKIEFPEVY----KWTKHMMRRPAV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 24/102 (24%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346
GST_C_Ure2p 208..350 CDD:198326 28/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.