DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and GTT1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:37/166 - (22%)
Similarity:65/166 - (39%) Gaps:40/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VNP-GKVQLNEEQVVTRTSGQKKSVAG----FASILES------LASESKSETAQNSRASREVEA 69
            ::| |:..|.|.|  .|.:|:||.:|.    |..:|:.      |.||......|.:.....||.
Yeast    50 IHPLGRSPLLEVQ--DRETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEG 112

  Fly    70 QVY--------------QWIEFSVLYVAPGSKDK----YVSKQLLADFN----KLFASKSYLVGH 112
            .:.              ..:.|.:.|:|....||    |.|.::...|:    ::..:..|||..
Yeast   113 SLQPPLMIEFILSKVKDSGMPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDG 177

  Fly   113 FITLADLAVYYAIYDLV--KSLSPVDKEVYLNLSRW 146
            .::.||:.:.:.:....  |..:|.|   |..:|:|
Yeast   178 KLSGADILMSFPLQMAFERKFAAPED---YPAISKW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 21/106 (20%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 12/38 (32%)
GST_C_GTT1_like 93..218 CDD:198298 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.