DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and TEF4

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:40/203 - (19%)
Similarity:62/203 - (30%) Gaps:74/203 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATVQKIANCLGVNPGKVQLNEEQVVTRTSGQKKSVAGFASILESLASESK--SETAQNSRASREV 67
            |.|:.....|...|.|.|..|:....::..:||.            .|:|  .:.|...:....:
Yeast   203 AEVKLAEKALTYTPPKKQKAEKPKAEKSKAEKKK------------DEAKPADDAAPAKKPKHPL 255

  Fly    68 EA-----------------------------QVYQWIEFSVLYVAPGSKDK----YVSKQLLAD- 98
            ||                             :.|...|:|:..|.....|:    ::|..|:.. 
Yeast   256 EALGKSTFVLDDWKRKYSNDDTRPVALPWFWEHYNPEEYSIWKVGYKYNDELTLTFMSNNLVGGF 320

  Fly    99 FNKLFASKSYLVG----------------------HFITLADLAVYYAIYDLVKSLSPV---DKE 138
            ||:|.||..|:.|                      .|....|:|..:..|:..| |.|.   |||
Yeast   321 FNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPAFDVAPDWESYEYTK-LDPTKEEDKE 384

  Fly   139 VYLNLSRW 146
            ...|:..|
Yeast   385 FVNNMWAW 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 28/141 (20%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342
GST_C_EF1Bgamma_like 89..211 CDD:198290 2/7 (29%)
EF1G 253..356 CDD:395522 16/102 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.