| Sequence 1: | NP_660194.1 | Gene: | AIMP3 / 246507 | FlyBaseID: | FBgn0050185 | Length: | 179 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_171791.1 | Gene: | GSTF7 / 839295 | AraportID: | AT1G02920 | Length: | 209 | Species: | Arabidopsis thaliana |
| Alignment Length: | 53 | Identity: | 12/53 - (22%) |
|---|---|---|---|
| Similarity: | 21/53 - (39%) | Gaps: | 13/53 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 111 GHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQNRADVHQGEPLL 163 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AIMP3 | NP_660194.1 | GST_C_AIMP3 | 65..166 | CDD:198338 | 12/53 (23%) |
| GSTF7 | NP_171791.1 | GST_N_Phi | 4..77 | CDD:239351 | 12/53 (23%) |
| GST_C_Phi | 95..209 | CDD:198296 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||