DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and GSTF7

DIOPT Version :10

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:53 Identity:12/53 - (22%)
Similarity:21/53 - (39%) Gaps:13/53 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQNRADVHQGEPLL 163
            ||..:.|...|..|:::             .||...|.|::.:...|:.||.:
plant     8 GHPASTATRRVLIALHE-------------KNLDFEFVHIELKDGEHKKEPFI 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 12/53 (23%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 12/53 (23%)
GST_C_Phi 95..209 CDD:198296
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.