DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and GSTZ2

DIOPT Version :10

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_178343.1 Gene:GSTZ2 / 814769 AraportID:AT2G02380 Length:223 Species:Arabidopsis thaliana


Alignment Length:67 Identity:15/67 - (22%)
Similarity:29/67 - (43%) Gaps:6/67 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KDKYVSKQLLADF---NKLFAS--KSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRW 146
            |..:::..:...|   .||..|  ..|..|..:.||||.:...|:....... ::.|.:..|:|:
plant   135 KTAWITNAITKGFTALEKLLVSCAGKYATGDEVYLADLFLAPQIHAAFNRFH-INMEPFPTLARF 198

  Fly   147 FD 148
            ::
plant   199 YE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 15/67 (22%)
GSTZ2NP_178343.1 maiA 13..220 CDD:273527 15/67 (22%)

Return to query results.
Submit another query.