DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and Gstz1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:61 Identity:18/61 - (29%)
Similarity:29/61 - (47%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YVSKQLLADFN---KLFASKS--YLVGHFITLAD--LAVYYAIYDLVK-SLSPVDKEVYLN 142
            :..|.:.:.||   |:..|.:  |.||..:::||  ||...|..:..| .|||.....::|
  Rat   130 WAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERFKVDLSPYPTISHIN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 18/61 (30%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340
maiA 7..211 CDD:273527 18/61 (30%)
Glutathione binding. /evidence=ECO:0000250 14..19
Glutathione binding. /evidence=ECO:0000250 71..72
GST_C_Zeta 93..207 CDD:198300 18/61 (30%)
Glutathione binding. /evidence=ECO:0000250 115..117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.