DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and Eef1e1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:160 Identity:56/160 - (35%)
Similarity:82/160 - (51%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCDVATVQKIANCLGVNPGK--VQLNEEQVVTRTSGQKKSVAGFASILESLASESKSETAQNSRA 63
            |...|.::.:...||:.||.  ....|.|:....:....|:.|.::|...|..::..|....|.|
Mouse     1 MAAAAELRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLVKQASKEHLLGSTA 65

  Fly    64 SREVEAQVYQWIEFSVLYVAPGSKDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDL 128
              |.:|.|.||:||.|..| .|...|..::.||.|.|.....|.||.||.|||||:.:||.::..
Mouse    66 --EEKAMVQQWLEFRVTRV-DGHSSKEDTQTLLKDLNSYLEDKVYLAGHNITLADILLYYGLHRF 127

  Fly   129 VKSLSPVDKEVYLNLSRWFDHLQNRADVHQ 158
            :..|:..:||.|||:||||.|:|:..|:.|
Mouse   128 IVDLTVQEKEKYLNVSRWFCHIQHYPDIRQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 41/94 (44%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 11/53 (21%)
Linker. /evidence=ECO:0000250 57..63 1/5 (20%)
C-terminal. /evidence=ECO:0000250 64..152 40/90 (44%)
GST_C_AIMP3 65..165 CDD:198338 42/96 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10215
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5057
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49206
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007808
OrthoInspector 1 1.000 - - oto92631
orthoMCL 1 0.900 - - OOG6_108114
Panther 1 1.100 - - LDO PTHR44490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5219
SonicParanoid 1 1.000 - - X5757
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.