DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and eef1e1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:140 Identity:47/140 - (33%)
Similarity:70/140 - (50%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TSGQKK----------SVAGFASILESLASESKSETAQNSRASREVEAQVYQWIEFSVLYVAPGS 86
            |.|.||          ::.|..:|...|..|:|........|  |..|.|.||:|..:..:...|
Zfish    23 TQGGKKVPVLQNNNGPALTGLVTIACHLVKEAKRPELLGDDA--EQRAVVQQWLEHRITKLDNCS 85

  Fly    87 KDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQ 151
            |::.  |.:|.|.|:....|.||.|:..||||:.:||.|:.::..|:..:||.|||:||||||:|
Zfish    86 KEEV--KVILKDLNRYLEDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKECYLNVSRWFDHIQ 148

  Fly   152 NRADVHQGEP 161
            :...:....|
Zfish   149 HYPGIRHHLP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 37/97 (38%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 38/99 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10067
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5245
OMA 1 1.010 - - QHG49206
OrthoDB 1 1.010 - - D1422931at2759
OrthoFinder 1 1.000 - - FOG0007808
OrthoInspector 1 1.000 - - oto38948
orthoMCL 1 0.900 - - OOG6_108114
Panther 1 1.100 - - LDO PTHR44490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5219
SonicParanoid 1 1.000 - - X5757
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.