DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and GstD5

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:185 Identity:40/185 - (21%)
Similarity:67/185 - (36%) Gaps:58/185 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TVQKIANCLGV---------------NPGKVQLNEEQVVTRTSGQKKSVAGFASILESLA----- 50
            ||..:|..|||               .|..|:||.:..:......     || ||.||.|     
  Fly    14 TVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDN-----GF-SIWESRAIAVYL 72

  Fly    51 --SESKSETAQNSRASREVEAQVYQWIEFSVLYVA-------------PGSKDKYVSKQLLADF- 99
              ...|.:|.......::.......:.:...||.:             |||.:.:  |::.:.| 
  Fly    73 VEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDF--KKIESSFE 135

  Fly   100 --NKLFASKSYLVGHFITLADLAVY-----YAIYDLVKSLSPVDKEVYLNLSRWF 147
              |.....::|:.|..:|:||:|:.     :.|:|.       |...|.|::||:
  Fly   136 YLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDF-------DLNKYPNVARWY 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 21/104 (20%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 40/185 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/65 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.