DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AIMP3 and gstt1b

DIOPT Version :9

Sequence 1:	NP_660194.1	Gene:	AIMP3 / 246507	FlyBaseID:	FBgn0050185	Length:	179	Species:	Drosophila melanogaster
Sequence 2:	NP_956878.1	Gene:	gstt1b / 393556	ZFINID:	ZDB-GENE-040426-1491	Length:	242	Species:	Danio rerio

Alignment Length:	140	Identity:	31/140 - (22%)
Similarity:	58/140 - (41%)	Gaps:	40/140 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    20 KVQLNE----EQVVTRTSGQKKSVAGFASIL-ESLASESKSETAQNSRASREVEAQVYQWIEFSV 79
            :.::||    :....|..|.|  :..|..:: |.|.:|...|..:|:..:..|..|::|
Zfish    92 RARVNEYLSWQHTSIRMHGAK--IIWFKILIPEVLGAEVPKEKMENAEENLNVALQLFQ------ 148

  Fly    80 LYVAPGSKDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLN-- 142
                    ||::.            .|.::||..|:||||.   ||.::::..: ...:|:.|
Zfish   149 --------DKFLQ------------DKPFIVGDQISLADLV---AIVEIMQPFA-AGMDVFENRP 189

  Fly   143 -LSRWFDHLQ 151
             |..|.|.::
Zfish   190 KLKAWKDRVR 199

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AIMP3	NP_660194.1	GST_C_AIMP3	65..166	CDD:198338	20/90 (22%)
gstt1b	NP_956878.1	GstA	1..199	CDD:223698	31/138 (22%)
		GST_N_Theta	3..78	CDD:239348
		GST_C_Theta	91..217	CDD:198292	31/140 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0625
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900