DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and GstE12

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:165 Identity:36/165 - (21%)
Similarity:66/165 - (40%) Gaps:44/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VNPGKVQLNEEQVVTRTSGQKKSVAGFASILESLA-----SESKSETAQN-------SRASREVE 68
            :.|..::||.:..:...      :.|.|:|::|.|     .|...:..|.       .||:  |:
  Fly    42 LTPEFLKLNPQHTIPTL------IDGEATIIDSHAICAYLVEKYGQKEQQLYPKELVQRAN--VD 98

  Fly    69 AQVY----------QWIEFSVLYVAPGSKD------KYVSK--QLLADFNKLFASKSYLVGHFIT 115
            |:::          :::...:||.  ||.|      .|:.|  ::|..|.|   .:.||.|..:|
  Fly    99 ARLHLDSGHLFARLRFLYEPILYY--GSTDCSIDKIAYIQKCWEILEGFLK---DQPYLCGSDLT 158

  Fly   116 LADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHL 150
            :||... .|....|...:|:|:..:..:..|...|
  Fly   159 IADFCA-VATVTSVNDTAPIDEFKFPKMHAWLKRL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 24/104 (23%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 8/40 (20%)
GstA 6..201 CDD:223698 36/165 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.