DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and GstE5

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:92 Identity:24/92 - (26%)
Similarity:42/92 - (45%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KDKYVSKQLLADFNKLF-ASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHL 150
            |::|.:...:.||.:.| |...|:.|..:|:||.::..:|..|| :...:|:..|..:..|...|
  Fly   129 KERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLV-AFVEIDRLKYPRIIEWVRRL 192

  Fly   151 Q--------NRADVHQGEPLL---NFT 166
            :        |.....:.|.:|   |||
  Fly   193 EKLPYYEEANAKGARELETILKSTNFT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 22/90 (24%)
GstE5NP_611327.1 GstA 4..196 CDD:223698 18/67 (27%)
Thioredoxin_like 4..77 CDD:294274
GST_C_Delta_Epsilon 91..209 CDD:198287 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.