powered by:
Protein Alignment AIMP3 and GstE14
DIOPT Version :9
Sequence 1: | NP_660194.1 |
Gene: | AIMP3 / 246507 |
FlyBaseID: | FBgn0050185 |
Length: | 179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610855.1 |
Gene: | GstE14 / 36467 |
FlyBaseID: | FBgn0033817 |
Length: | 232 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 13/47 - (27%) |
Similarity: | 25/47 - (53%) |
Gaps: | 3/47 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 SKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQ 151
:..::.|..:|||||::...: ..|..:.|:.: :..|.|||..:|
Fly 150 NSDFMAGPQLTLADLSIVTTL-STVNLMFPLSQ--FPRLRRWFTAMQ 193
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.