DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and Mars1

DIOPT Version :10

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001165053.1 Gene:Mars1 / 216443 MGIID:1345633 Length:910 Species:Mus musculus


Alignment Length:98 Identity:20/98 - (20%)
Similarity:45/98 - (45%) Gaps:18/98 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QWIEFSVLYVAP------------GSKDKYV---SKQLLADFNKLFASKS--YLVGHFITLADLA 120
            ||:|:....:.|            |.|.:.:   .:::|...:...:.::  :|.|...:|||:.
Mouse    83 QWLEWEATELQPVLSAALHCLVVQGKKGEDILGPLRRVLTHIDHSLSRQNCPFLAGDTESLADIV 147

  Fly   121 VYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQNR 153
            ::.|:|.|::..:.:.:|:.. |..||..|..:
Mouse   148 LWGALYPLLQDPAYLPEELGA-LQSWFQTLSTQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 20/98 (20%)
Mars1NP_001165053.1 GST_N_5 1..74 CDD:436537
GST_C_MetRS_N 77..179 CDD:198340 20/96 (21%)
PLN02610 258..>848 CDD:215329
'HIGH' region 275..285
'KMSKS' region 595..599
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.