powered by:
Protein Alignment AIMP3 and gst-43
DIOPT Version :9
Sequence 1: | NP_660194.1 |
Gene: | AIMP3 / 246507 |
FlyBaseID: | FBgn0050185 |
Length: | 179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491070.1 |
Gene: | gst-43 / 190586 |
WormBaseID: | WBGene00001791 |
Length: | 214 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 21/68 - (30%) |
Similarity: | 32/68 - (47%) |
Gaps: | 9/68 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 PGSKD----KYVSKQLLADFNKLFASKS--YLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLN 142
||..| .:|:|..|| ..:|....| |.||..:|:||:.:...||: ..:..||...|..
Worm 124 PGYGDFWCNHFVNKGFLA-LEELLKKHSGKYCVGDQLTIADINLPSIIYN--AKIYKVDMSKYPT 185
Fly 143 LSR 145
::|
Worm 186 ITR 188
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.