DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and Gstz1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:158 Identity:36/158 - (22%)
Similarity:63/158 - (39%) Gaps:37/158 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VNPGKVQLNEEQVVTRTSGQKKSVAGF----ASILESLA-SESKSET----------AQNSRASR 65
            :..|..|..||   .:|....|.|...    .:|::||| .|...||          .|.....|
Mouse    39 IKDGGQQFTEE---FQTLNPMKQVPALKIDGITIVQSLAIMEYLEETRPIPRLLPQDPQKRAIVR 100

  Fly    66 EVEAQVYQWIE----FSVL-YVAPGSKDKYVSKQLLADFN---KLFASKS--YLVGHFITLADLA 120
            .:...:...|:    .||| .|...::.::..|.:.:.||   |:..|.:  |.||..:::||:.
Mouse   101 MISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVC 165

  Fly   121 VYYAIYDLVK---SLSP------VDKEV 139
            :...:.:..:   .|||      ::||:
Mouse   166 LVPQVANAERFKVDLSPYPTISHINKEL 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 21/94 (22%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 12/43 (28%)
maiA 7..211 CDD:273527 36/158 (23%)
Glutathione binding 14..19