DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and vars1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:135 Identity:33/135 - (24%)
Similarity:68/135 - (50%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VAGFASILESLASESKSETAQNSRASREVEAQVYQWIEFSVLYVAPGS------------KDKYV 91
            ::|.:::...||:     |.:.:.:.::.|:||:||:.|:...:.|.:            .||.:
Zfish    57 LSGTSAVSWYLAA-----TGKRAGSDKKQESQVWQWLSFAENELTPVACAVAFPLLGIMGVDKKL 116

  Fly    92 SKQLLADFNKL-------FASKSYLVGHFITLADLAV-YYAIYDLVKSLSPVDKEVYLNLSRWFD 148
            .:...|:..::       .|.:::|||..:||||.|| ..|:.....:|.|.|::..:|::|||:
Zfish   117 QQSSRAELLRVLKALDGTLALRTFLVGESVTLADAAVAMAALLPFKYALEPADRKSLVNVTRWFN 181

  Fly   149 HLQNR 153
            ...|:
Zfish   182 TCVNQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 29/109 (27%)
vars1NP_001298275.1 GstA <45..192 CDD:223698 33/135 (24%)
GST_C_ValRS_N 80..202 CDD:198327 29/107 (27%)
PTZ00419 291..1270 CDD:240411
ValRS_core 340..941 CDD:185677
tRNA-synt_1_2 518..643 CDD:290334
Anticodon_Ia_Val 941..1081 CDD:153416
Val_tRNA-synt_C 1203..1266 CDD:287436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.