DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and vars1

DIOPT Version :10

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:135 Identity:33/135 - (24%)
Similarity:68/135 - (50%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VAGFASILESLASESKSETAQNSRASREVEAQVYQWIEFSVLYVAPGS------------KDKYV 91
            ::|.:::...||:     |.:.:.:.::.|:||:||:.|:...:.|.:            .||.:
Zfish    57 LSGTSAVSWYLAA-----TGKRAGSDKKQESQVWQWLSFAENELTPVACAVAFPLLGIMGVDKKL 116

  Fly    92 SKQLLADFNKL-------FASKSYLVGHFITLADLAV-YYAIYDLVKSLSPVDKEVYLNLSRWFD 148
            .:...|:..::       .|.:::|||..:||||.|| ..|:.....:|.|.|::..:|::|||:
Zfish   117 QQSSRAELLRVLKALDGTLALRTFLVGESVTLADAAVAMAALLPFKYALEPADRKSLVNVTRWFN 181

  Fly   149 HLQNR 153
            ...|:
Zfish   182 TCVNQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 29/109 (27%)
vars1NP_001298275.1 GST_C_ValRS_N 80..202 CDD:198327 29/107 (27%)
PTZ00419 291..1270 CDD:240411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.