DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP3 and eef1e1

DIOPT Version :9

Sequence 1:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 / 100038230 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis


Alignment Length:166 Identity:54/166 - (32%)
Similarity:85/166 - (51%) Gaps:20/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IANCLGVNPGKVQLNEEQVVTRTSGQKK----------SVAGFASILESLASESKSETAQNSRAS 64
            :..|||:|.||..       :|..|..|          |:.|.::|...|..|:|.|....|.| 
 Frog     9 LEKCLGLNSGKYS-------SRAQGAGKIPVLQTNKGPSLVGLSTIASHLVKEAKKEELLGSTA- 65

  Fly    65 REVEAQVYQWIEFSVLYVAPGSKDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDLV 129
             |.:|.|.||:|:.:.|:...|..:.: :.:|.|.|.....|.::.|:.:||||:.:||.::.::
 Frog    66 -EEKAIVQQWLEYRISYIDRASSKEDI-RNVLNDLNHYLKDKVFVAGNTVTLADILIYYGLHPVI 128

  Fly   130 KSLSPVDKEVYLNLSRWFDHLQNRADVHQGEPLLNF 165
            ..||..:||.|:|:||||.|:||...:.|..|.|.|
 Frog   129 TGLSVQEKETYINVSRWFSHIQNYPGIRQHLPSLVF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 36/101 (36%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 37/103 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10210
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4915
OMA 1 1.010 - - QHG49206
OrthoDB 1 1.010 - - D1422931at2759
OrthoFinder 1 1.000 - - FOG0007808
OrthoInspector 1 1.000 - - oto102927
Panther 1 1.100 - - LDO PTHR44490
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5757
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.